CacheBy
Atlas Antibodies Anti-BCAT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BCAT2 Antibody

상품 한눈에 보기

Human BCAT2 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 Western blot 분석에 적합하며, Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. Rabbit 유래 IgG로 Affinity purification 수행, 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054091-100 Anti-BCAT2 Antibody, branched chain amino-acid transaminase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054091-25 Anti-BCAT2 Antibody, branched chain amino-acid transaminase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BCAT2 Antibody

Anti-BCAT2 Antibody

Target: Branched chain amino-acid transaminase 2, mitochondrial
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human BCAT2.


Alternative Gene Names

BCAM, BCT2

Open Datasheet


Specifications

항목 내용
Target Protein Branched chain amino-acid transaminase 2, mitochondrial
Target Gene BCAT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030826 (73%), Rat ENSRNOG00000020956 (70%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.