
1 / 2
Atlas Antibodies Anti-BCAR3 Antibody
상품 한눈에 보기
Human BCAR3 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. Rabbit 유래 IgG 항체이며, Affinity purification으로 높은 특이성과 재현성을 제공합니다. BCAR3 단백질 발현의 정량 및 위치 분석에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BCAR3 Antibody
Target: breast cancer anti-estrogen resistance 3 (BCAR3)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human BCAR3
Alternative Gene Names
NSP2, SH2D3B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | breast cancer anti-estrogen resistance 3 |
| Target Gene | BCAR3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000013737 | 81% |
| Mouse | ENSMUSG00000028121 | 79% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BCAS3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCAS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCAR3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCAS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCAS3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.