CacheBy
Atlas Antibodies Anti-BCAR3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BCAR3 Antibody

상품 한눈에 보기

Human BCAR3 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. Rabbit 유래 IgG 항체이며, Affinity purification으로 높은 특이성과 재현성을 제공합니다. BCAR3 단백질 발현의 정량 및 위치 분석에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014858-100 Anti-BCAR3 Antibody, breast cancer anti-estrogen resistance 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014858-25 Anti-BCAR3 Antibody, breast cancer anti-estrogen resistance 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BCAR3 Antibody

Anti-BCAR3 Antibody

Target: breast cancer anti-estrogen resistance 3 (BCAR3)
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human BCAR3

Alternative Gene Names

NSP2, SH2D3B

Open Datasheet

Target Information

항목 내용
Target Protein breast cancer anti-estrogen resistance 3
Target Gene BCAR3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL

Verified Species Reactivity

Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000013737 81%
Mouse ENSMUSG00000028121 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.