CacheBy
Atlas Antibodies Anti-BAZ1B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BAZ1B Antibody

상품 한눈에 보기

Human BAZ1B 단백질을 인식하는 토끼 폴리클로날 항체로, PrEST 항원을 이용해 친화정제됨. ICC 등 다양한 응용에 적합하며, 인간에 대해 검증됨. WBSCR10/WSTF 등 대체 유전자명으로도 알려짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067010-100 Anti-BAZ1B Antibody, bromodomain adjacent to zinc finger domain, 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067010-25 Anti-BAZ1B Antibody, bromodomain adjacent to zinc finger domain, 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BAZ1B Antibody

Anti-BAZ1B Antibody

Target Protein: bromodomain adjacent to zinc finger domain, 1B
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human BAZ1B protein (bromodomain adjacent to zinc finger domain, 1B).

Alternative Gene Names

WBSCR10, WBSCR9, WSTF

Open Datasheet


Target Information

항목 내용
Target Protein bromodomain adjacent to zinc finger domain, 1B
Target Gene BAZ1B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000002748 (86%), Rat ENSRNOG00000001453 (86%)

Antigen Sequence:
RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


ICC (Immunocytochemistry)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.