AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BAP1 Antibody
상품 한눈에 보기
BRCA1 관련 단백질 BAP1을 인식하는 사람 유래 폴리클로날 항체. 면역형광 등 다양한 응용에 적합. 토끼에서 생산된 IgG 항체로, 프레스티지 항원으로 친화 정제됨. 인간에 반응성이 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028815-100 Anti-BAP1 Antibody, BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028815-25 Anti-BAP1 Antibody, BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BAP1 Antibody
Anti-BAP1 Antibody
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human BAP1.
Alternative Gene Names
- hucep-6
- KIAA0272
- UCHL2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) |
| Target Gene | BAP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000021901 (100%), Rat ENSRNOG00000019097 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.