CacheBy
Atlas Antibodies Anti-BANK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BANK1 Antibody

상품 한눈에 보기

인간 BANK1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 오쏘고날 검증 완료. Rabbit 유래 IgG이며 PrEST 항원을 이용해 친화 정제됨. Human 반응성 확인, BANK 및 FLJ20706 대체 유전자명 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037002-100 Anti-BANK1 Antibody, B-cell scaffold protein with ankyrin repeats 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037002-25 Anti-BANK1 Antibody, B-cell scaffold protein with ankyrin repeats 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BANK1 Antibody

Anti-BANK1 Antibody

B-cell scaffold protein with ankyrin repeats 1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human BANK1


Alternative Gene Names

BANK, FLJ20706

Open Datasheet


Target Information

항목 내용
Target Protein B-cell scaffold protein with ankyrin repeats 1
Target Gene BANK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Ortholog Identity Rat ENSRNOG00000032247 (55%), Mouse ENSMUSG00000037922 (50%)

Antigen Sequence:
RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.