CacheBy
Atlas Antibodies Anti-BAG6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BAG6 Antibody

상품 한눈에 보기

Human BAG6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. BAT3/D6S52E/G3 유전자 대체명으로 알려진 BAG6 단백질 연구에 적합. 고순도 Affinity 정제 및 PBS/glycerol buffer 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045116-100 Anti-BAG6 Antibody, BCL2-associated athanogene 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045116-25 Anti-BAG6 Antibody, BCL2-associated athanogene 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BAG6 Antibody

Anti-BAG6 Antibody

BCL2-associated athanogene 6


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human BAG6


Alternative Gene Names

BAT3, D6S52E, G3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein BCL2-associated athanogene 6
Target Gene BAG6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence APETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRPMSHYTT
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000000851 (95%), Mouse ENSMUSG00000024392 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.