CacheBy
Atlas Antibodies Anti-BAD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BAD Antibody

상품 한눈에 보기

인간 BAD 단백질에 특이적인 폴리클로날 항체로, BCL2 관련 세포사멸 조절 연구에 적합합니다. Rabbit 유래 IgG 항체이며, IHC 및 ICC 응용에 권장됩니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062105-100 Anti-BAD Antibody, BCL2-associated agonist of cell death 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062105-25 Anti-BAD Antibody, BCL2-associated agonist of cell death 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BAD Antibody

Anti-BAD Antibody

BCL2-associated agonist of cell death

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human BAD protein.

Alternative Gene Names

BBC2, BCL2L8

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein BCL2-associated agonist of cell death
Target Gene BAD
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000024959 (59%), Rat ENSRNOG00000021147 (57%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.