CacheBy
Atlas Antibodies Anti-BAAT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BAAT Antibody

상품 한눈에 보기

Human BAAT 단백질을 인식하는 토끼 폴리클로날 항체로, bile acid CoA:amino acid N-acyltransferase 연구에 적합합니다. IHC 등 다양한 응용 가능하며, PrEST 항원으로 친화 정제되었습니다. 고순도 IgG 형태로 PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021330-100 Anti-BAAT Antibody, bile acid CoA:amino acid N-acyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021330-25 Anti-BAAT Antibody, bile acid CoA:amino acid N-acyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BAAT Antibody

Anti-BAAT Antibody

Target Information

  • Target Protein: bile acid CoA:amino acid N-acyltransferase
  • Target Gene: BAAT
  • Alternative Gene Names: BAT

면역조직화학(IHC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal Antibody against Human BAAT

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLGGDYMGVH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000039653 72%
Rat ENSRNOG00000007395 72%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.