CacheBy
Atlas Antibodies Anti-B3GNT9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B3GNT9 Antibody

상품 한눈에 보기

인간 B3GNT9 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되어 신뢰성 높은 실험 결과를 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062734-100 Anti-B3GNT9 Antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062734-25 Anti-B3GNT9 Antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B3GNT9 Antibody

Anti-B3GNT9 Antibody

Target Protein: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human B3GNT9


Alternative Gene Names

  • MGC4655

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
ELVVVHGLSAADIWLMWRLLHGPHGPACAHPQPVAAGPFQWDS


Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000069920 91%
Rat ENSRNOG00000053895 91%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.