CacheBy
Atlas Antibodies Anti-B3GALT4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B3GALT4 Antibody

상품 한눈에 보기

Human B3GALT4 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학 등 다양한 연구용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043001-100 Anti-B3GALT4 Antibody, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043001-25 Anti-B3GALT4 Antibody, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B3GALT4 Antibody

Anti-B3GALT4 Antibody

Target: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against Human B3GALT4.


Alternative Gene Names

  • beta3Gal-T4
  • GalT4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Target Gene B3GALT4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (89%), Rat (88%)

Antigen Sequence:
PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA


Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 적합한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.