
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-B3GALT4 Antibody
상품 한눈에 보기
Human B3GALT4 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학 등 다양한 연구용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대한 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043001-100 Anti-B3GALT4 Antibody, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043001-25 Anti-B3GALT4 Antibody, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-B3GALT4 Antibody
Anti-B3GALT4 Antibody
Target: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against Human B3GALT4.
Alternative Gene Names
- beta3Gal-T4
- GalT4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 |
| Target Gene | B3GALT4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (89%), Rat (88%) |
Antigen Sequence:
PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 적합한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



