CacheBy
Atlas Antibodies Anti-AVIL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AVIL Antibody

상품 한눈에 보기

Human AVIL 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 대한 반응성이 검증됨. ADVIL, DOC6 등 대체 유전자명 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058864-100 Anti-AVIL Antibody, advillin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058864-25 Anti-AVIL Antibody, advillin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AVIL Antibody

Anti-AVIL Antibody

Target Information

  • Target Protein: advillin
  • Target Gene: AVIL
  • Alternative Gene Names: ADVIL, DOC6, FLJ12386, p92

IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against Human AVIL.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000050419 (91%)
  • Mouse ENSMUSG00000025432 (90%)

Clonality and Isotype

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

구성 요소 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.