
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AUH Antibody
상품 한눈에 보기
인간 AUH 단백질을 타깃으로 하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. RNA-seq 데이터 기반 직교 검증 수행. Rabbit 유래 IgG 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA004171-100 Anti-AUH Antibody, AU RNA binding protein/enoyl-CoA hydratase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004171-25 Anti-AUH Antibody, AU RNA binding protein/enoyl-CoA hydratase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AUH Antibody
Anti-AUH Antibody
AU RNA binding protein / enoyl-CoA hydratase
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human AUH
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | AU RNA binding protein / enoyl-CoA hydratase |
| Target Gene | AUH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK |
Verified Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000021460 (70%)
- Rat ENSRNOG00000011684 (67%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



