CacheBy
Atlas Antibodies Anti-AUH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AUH Antibody

상품 한눈에 보기

인간 AUH 단백질을 타깃으로 하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. RNA-seq 데이터 기반 직교 검증 수행. Rabbit 유래 IgG 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004171-100 Anti-AUH Antibody, AU RNA binding protein/enoyl-CoA hydratase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004171-25 Anti-AUH Antibody, AU RNA binding protein/enoyl-CoA hydratase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AUH Antibody

Anti-AUH Antibody

AU RNA binding protein / enoyl-CoA hydratase

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human AUH

Open Datasheet

Target Information

항목 내용
Target Protein AU RNA binding protein / enoyl-CoA hydratase
Target Gene AUH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK

Verified Species Reactivity

반응성
Human Verified

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000021460 (70%)
  • Rat ENSRNOG00000011684 (67%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.