CacheBy
Atlas Antibodies Anti-ATXN10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATXN10 Antibody

상품 한눈에 보기

Human ATXN10 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 다양한 종 간 교차 반응성 정보 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049531-100 Anti-ATXN10 Antibody, ataxin 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049531-25 Anti-ATXN10 Antibody, ataxin 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATXN10 Antibody

Anti-ATXN10 Antibody

Target Information

  • Target Protein: ataxin 10
  • Target Gene: ATXN10
  • Alternative Gene Names: E46L, FLJ37990, SCA10

Product Description

Polyclonal antibody against human ATXN10.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for use in IHC, WB, and ICC applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000014637 82%
Mouse ENSMUSG00000016541 72%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen
Applications IHC, WB, ICC

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.