
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ATR Antibody
상품 한눈에 보기
Human ATR 단백질을 인식하는 토끼 폴리클로날 항체로, ATR serine/threonine kinase 연구에 적합합니다. PrEST 항원을 이용해 정제되었으며, 인간에 대한 반응성이 검증되었습니다. 40% 글리세롤과 PBS 완충액에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054320-100 Anti-ATR Antibody, ATR serine/threonine kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054320-25 Anti-ATR Antibody, ATR serine/threonine kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ATR Antibody
Anti-ATR Antibody
Product Description
Polyclonal antibody against human ATR (serine/threonine kinase).
Validated for use in research applications related to DNA damage response and cell cycle regulation.
Alternative Gene Names
FRP1, MEC1, SCKL, SCKL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATR serine/threonine kinase |
| Target Gene | ATR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000010027 (95%), Mouse ENSMUSG00000032409 (94%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer and Storage
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Recommended Applications
- Immunocytochemistry (ICC)
- Further optimization by end user may be required for other applications.
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Open Datasheet (PDF)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



