CacheBy
Atlas Antibodies Anti-ATP8A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP8A1 Antibody

상품 한눈에 보기

Human ATP8A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원으로 친화 정제되었으며, RNA-seq 기반 직교 검증을 통해 신뢰성 높은 단백질 발현 분석이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052935-100 Anti-ATP8A1 Antibody, ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052935-25 Anti-ATP8A1 Antibody, ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP8A1 Antibody

Anti-ATP8A1 Antibody

ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human ATP8A1


Alternative Gene Names

  • ATPIA

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1
Target Gene ATP8A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVI
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000034200 (100%), Mouse ENSMUSG00000037685 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.