CacheBy
Atlas Antibodies Anti-ATP6V1G3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP6V1G3 Antibody

상품 한눈에 보기

인간 ATP6V1G3 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 RNA-seq 기반 Orthogonal 검증 완료. Rabbit 유래 IgG 항체로 PrEST 항원 친화 정제. 인간 반응성 확인, 40% 글리세롤 PBS 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028701-100 Anti-ATP6V1G3 Antibody, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028701-25 Anti-ATP6V1G3 Antibody, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP6V1G3 Antibody

Anti-ATP6V1G3 Antibody

ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human ATP6V1G3.

Alternative Gene Names

ATP6G3, Vma10

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
Target Gene ATP6V1G3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026394 (80%), Rat ENSRNOG00000022480 (78%)

Antigen Sequence:

AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.