CacheBy
Atlas Antibodies Anti-ATP5S Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP5S Antibody

상품 한눈에 보기

Human ATP5S 단백질을 인식하는 토끼 폴리클로날 항체로, ATP 합성효소 Fo 복합체의 소단위 s를 타깃으로 함. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046967-100 Anti-ATP5S Antibody, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046967-25 Anti-ATP5S Antibody, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP5S Antibody

Anti-ATP5S Antibody

ATP synthase, H⁺ transporting, mitochondrial Fo complex, subunit s (factor B)

면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.

Product Description

Polyclonal antibody against Human ATP5S.

Alternative Gene Names

ATPW, HSU79253

Open Datasheet (PDF)

Target Information

  • Target Protein: ATP synthase, H⁺ transporting, mitochondrial Fo complex, subunit s (factor B)
  • Target Gene: ATP5S
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000054894 67%
Rat ENSRNOG00000004893 66%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.