CacheBy
Atlas Antibodies Anti-ATP2B4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP2B4 Antibody

상품 한눈에 보기

인간 ATP2B4 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합. 정제된 PrEST 항원 기반 친화 정제 방식 사용. Orthogonal validation으로 RNA-seq 데이터와 비교 검증 완료. 토끼 유래 IgG 형식, 인간 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040431-100 Anti-ATP2B4 Antibody, ATPase, Ca++ transporting, plasma membrane 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040431-25 Anti-ATP2B4 Antibody, ATPase, Ca++ transporting, plasma membrane 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP2B4 Antibody

Anti-ATP2B4 Antibody

ATPase, Ca++ transporting, plasma membrane 4

  • Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against Human ATP2B4.

Alternative Gene Names

ATP2B2, MXRA1, PMCA4

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ATPase, Ca++ transporting, plasma membrane 4
Target Gene ATP2B4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence THPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026463 (53%)
Rat ENSRNOG00000003031 (46%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.