CacheBy
Atlas Antibodies Anti-ATP1B2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP1B2 Antibody

상품 한눈에 보기

인간 ATP1B2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 분석에 적합하며 RNA-seq 데이터 기반 정합 검증 완료. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010698-100 Anti-ATP1B2 Antibody, ATPase, Na+/K+ transporting, beta 2 polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010698-25 Anti-ATP1B2 Antibody, ATPase, Na+/K+ transporting, beta 2 polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP1B2 Antibody

Anti-ATP1B2 Antibody

ATPase, Na⁺/K⁺ transporting, beta 2 polypeptide

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human ATP1B2.

Alternative Gene Names

  • AMOG

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ATPase, Na⁺/K⁺ transporting, beta 2 polypeptide
Target Gene ATP1B2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDST
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011227 (98%), Mouse ENSMUSG00000041329 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.