
1 / 2
Atlas Antibodies Anti-ATF7IP2 Antibody
상품 한눈에 보기
Human ATF7IP2 단백질을 인식하는 Rabbit Polyclonal 항체. IHC를 통한 Orthogonal Validation 수행. PrEST 항원을 이용한 Affinity 정제. Human에 반응하며 RNA-seq 데이터 기반 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATF7IP2 Antibody
activating transcription factor 7 interacting protein 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ATF7IP2
Alternative Gene Names
- FLJ12668
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | activating transcription factor 7 interacting protein 2 |
| Target Gene | ATF7IP2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | SVESPNLTTPITSNPTDTRKITSGNSSNSPNAEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPPAPL |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000039200 | 58% |
| Rat | ENSRNOG00000025522 | 40% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATF3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATF7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATF7IP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATF6B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATF7IP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.