CacheBy
Atlas Antibodies Anti-ASZ1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ASZ1 Antibody

상품 한눈에 보기

Human ASZ1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원을 이용해 친화 정제되었으며, 40% glycerol 및 PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020558-100 Anti-ASZ1 Antibody, ankyrin repeat, SAM and basic leucine zipper domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020558-25 Anti-ASZ1 Antibody, ankyrin repeat, SAM and basic leucine zipper domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASZ1 Antibody

Anti-ASZ1 Antibody

ankyrin repeat, SAM and basic leucine zipper domain containing 1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human ASZ1.


Alternative Gene Names

ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3

Open Datasheet


Target Information

항목 내용
Target Protein ankyrin repeat, SAM and basic leucine zipper domain containing 1
Target Gene ASZ1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000010796 (90%), Rat ENSRNOG00000060343 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.