
1 / 2
Atlas Antibodies Anti-ASTN1 Antibody
상품 한눈에 보기
Human ASTN1 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산되었습니다. 면역세포화학(ICC) 등 다양한 응용에 적합하며, 고순도의 Affinity purification 방식으로 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ASTN1 Antibody
Target Protein: Astrotactin 1 (ASTN1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ASTN1.
Alternative Gene Names
- ASTN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Astrotactin 1 |
| Target Gene | ASTN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EDYKLGVDGRSCQLITETCPEGSDCGESRELPMNQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQLPDGLVVATVPLENQCLEEISEPT |
Verified Species Reactivity
- Human
Interspecies Sequence Identity
| Species | Gene ID | Identity |
|----------|----------|-----------|
| Mouse | ENSMUSG00000026587 | 94% |
| Rat | ENSRNOG00000060105 | 47% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 실험 목적에 따라 사용자가 직접 설정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ASXL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ASTE1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ASTN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ASTN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ASRGL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.