CacheBy
Atlas Antibodies Anti-ASTN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ASTN1 Antibody

상품 한눈에 보기

Human ASTN1 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산되었습니다. 면역세포화학(ICC) 등 다양한 응용에 적합하며, 고순도의 Affinity purification 방식으로 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074112-100 Anti-ASTN1 Antibody, astrotactin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074112-25 Anti-ASTN1 Antibody, astrotactin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASTN1 Antibody

Anti-ASTN1 Antibody

Target Protein: Astrotactin 1 (ASTN1)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ASTN1.


Alternative Gene Names

  • ASTN

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Astrotactin 1
Target Gene ASTN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EDYKLGVDGRSCQLITETCPEGSDCGESRELPMNQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQLPDGLVVATVPLENQCLEEISEPT

Verified Species Reactivity

  • Human

Interspecies Sequence Identity
| Species | Gene ID | Identity |
|----------|----------|-----------|
| Mouse | ENSMUSG00000026587 | 94% |
| Rat | ENSRNOG00000060105 | 47% |


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 실험 목적에 따라 사용자가 직접 설정해야 합니다.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.