AI 생성

1 / 2

Atlas Antibodies Anti-ASPRV1 Antibody

상품 한눈에 보기

Human ASPRV1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 오쏘고날 검증에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, RNA-seq 데이터 비교를 통한 단백질 발현 검증이 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA034810-100 Anti-ASPRV1 Antibody, aspartic peptidase, retroviral-like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA034810-25 Anti-ASPRV1 Antibody, aspartic peptidase, retroviral-like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Aspartic peptidase, retroviral-like 1 (ASPRV1)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human ASPRV1.

FLJ25084, SASPase, Taps

항목	내용
Target Protein	Aspartic peptidase, retroviral-like 1
Target Gene	ASPRV1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (80%), Rat (30%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

GKLKLKAQFLVANASAEEAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEEDPSSEEGRQELSH

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.