CacheBy
Atlas Antibodies Anti-ASNS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ASNS Antibody

상품 한눈에 보기

인간 ASNS 단백질을 표적으로 하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. 고순도 Affinity 정제 방식으로 제조되었으며, PBS와 글리세롤 버퍼에 보존됩니다.

카탈로그번호
HPA029318-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029318-100 Anti-ASNS Antibody, asparagine synthetase (glutamine-hydrolyzing) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029318-25 Anti-ASNS Antibody, asparagine synthetase (glutamine-hydrolyzing) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASNS Antibody

Anti-ASNS Antibody

Target: asparagine synthetase (glutamine-hydrolyzing)
Supplier: Atlas Antibodies


  • WB (Orthogonal validation): Orthogonal validation of protein expression using Western Blot by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Suitable for immunocytochemistry.

Product Description

Polyclonal Antibody against Human ASNS
Open Datasheet


Target Information

항목 내용
Target Protein asparagine synthetase (glutamine-hydrolyzing)
Target Gene ASNS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP

Species Reactivity

Verified Species Human
Mouse Ortholog ENSMUSG00000029752 (94%)
Rat Ortholog ENSRNOG00000007546 (93%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal Validation
Orthogonal Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.