
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ASNS Antibody
상품 한눈에 보기
인간 ASNS 단백질을 표적으로 하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. 고순도 Affinity 정제 방식으로 제조되었으며, PBS와 글리세롤 버퍼에 보존됩니다.
- 카탈로그번호
- HPA029318-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029318-100 Anti-ASNS Antibody, asparagine synthetase (glutamine-hydrolyzing) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029318-25 Anti-ASNS Antibody, asparagine synthetase (glutamine-hydrolyzing) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ASNS Antibody
Anti-ASNS Antibody
Target: asparagine synthetase (glutamine-hydrolyzing)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Orthogonal validation): Orthogonal validation of protein expression using Western Blot by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Suitable for immunocytochemistry.
Product Description
Polyclonal Antibody against Human ASNS
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | asparagine synthetase (glutamine-hydrolyzing) |
| Target Gene | ASNS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP |
Species Reactivity
| Verified Species | Human |
|---|---|
| Mouse Ortholog | ENSMUSG00000029752 (94%) |
| Rat Ortholog | ENSRNOG00000007546 (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



