
원본
Atlas Antibodies Anti-ASIC5 Antibody
상품 한눈에 보기
Human ASIC5 단백질을 인식하는 토끼 폴리클로날 항체로, 산 감지 이온 채널 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 인간에 반응하며, Rat 및 Mouse와 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029444-100 Anti-ASIC5 Antibody, acid-sensing (proton-gated) ion channel family member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029444-25 Anti-ASIC5 Antibody, acid-sensing (proton-gated) ion channel family member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ASIC5 Antibody
Anti-ASIC5 Antibody
acid-sensing (proton-gated) ion channel family member 5
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal Antibody against Human ASIC5
Alternative Gene Names
- ACCN5
- HINAC
- INAC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | acid-sensing (proton-gated) ion channel family member 5 |
| Target Gene | ASIC5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000011842 | 78% |
| Mouse | ENSMUSG00000028008 | 76% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



