CacheBy
Atlas Antibodies Anti-ASGR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ASGR2 Antibody

상품 한눈에 보기

인간 ASGR2 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. RNA-seq 데이터와 비교한 정교한 Orthogonal 검증을 통해 높은 신뢰성을 제공합니다. 친화 정제된 고순도 항체로 다양한 조직 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014899-100 Anti-ASGR2 Antibody, asialoglycoprotein receptor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014899-25 Anti-ASGR2 Antibody, asialoglycoprotein receptor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASGR2 Antibody

Anti-ASGR2 Antibody

Target: asialoglycoprotein receptor 2 (ASGR2)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human ASGR2.


Alternative Gene Names

  • CLEC4H2

Target Information

항목 내용
Target Protein asialoglycoprotein receptor 2
Target Gene ASGR2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (60%), Rat (56%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Antigen Sequence

QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCC

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.