Atlas Antibodies Anti-NNMT Antibody

상품 한눈에 보기

인간 NNMT 단백질을 인식하는 폴리클로날 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체입니다.

카탈로그번호: HPA059180-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059180-100 Anti-NNMT Antibody, nicotinamide N-methyltransferase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059180-25 Anti-NNMT Antibody, nicotinamide N-methyltransferase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NNMT Antibody

Anti-NNMT Antibody

Target: nicotinamide N-methyltransferase (NNMT)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, Orthogonal validation)
Immunocytochemistry (ICC)

Orthogonal validation:
Protein expression verified using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human NNMT
Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	nicotinamide N-methyltransferase
Target Gene	NNMT
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRP
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000005930 (79%), Mouse ENSMUSG00000032271 (79%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.