CacheBy
Atlas Antibodies Anti-NMNAT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NMNAT3 Antibody

상품 한눈에 보기

Human NMNAT3 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 대한 검증 완료.

카탈로그번호
HPA057402-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057402-100 Anti-NMNAT3 Antibody, nicotinamide nucleotide adenylyltransferase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057402-25 Anti-NMNAT3 Antibody, nicotinamide nucleotide adenylyltransferase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NMNAT3 Antibody

Anti-NMNAT3 Antibody

Target Protein: nicotinamide nucleotide adenylyltransferase 3
Alternative Gene Name: PNAT3

면역세포화학(ICC) 등 다양한 연구 응용에 적합.

Product Description

Polyclonal Antibody against Human NMNAT3.

Target Information

  • Target Gene: NMNAT3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    MHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIR
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Mouse ENSMUSG00000032456 (92%)
    • Rat ENSRNOG00000013585 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 희석 배수 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.