CacheBy
Atlas Antibodies Anti-NMNAT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NMNAT3 Antibody

상품 한눈에 보기

인간 NMNAT3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. 면역염색 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. PBS 및 글리세롤 버퍼로 안정화되어 장기 보관에 용이합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039077-100 Anti-NMNAT3 Antibody, nicotinamide nucleotide adenylyltransferase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039077-25 Anti-NMNAT3 Antibody, nicotinamide nucleotide adenylyltransferase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NMNAT3 Antibody

Anti-NMNAT3 Antibody

Target: nicotinamide nucleotide adenylyltransferase 3
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)
  • Other immunoassays (user optimization required)

Product Description

Polyclonal antibody against Human NMNAT3.


Alternative Gene Names

  • PNAT3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nicotinamide nucleotide adenylyltransferase 3
Target Gene NMNAT3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIR

Verified Species Reactivity

  • Human

Interspecies Information

종 Ortholog ID Sequence Identity
Rat ENSRNOG00000013585 92%
Mouse ENSMUSG00000032456 92%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.