CacheBy
Atlas Antibodies Anti-NMI Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NMI Antibody

상품 한눈에 보기

Human NMI 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 및 PBS 완충액에 보존됩니다. 사람에 대해 검증되었고, 마우스 및 랫과의 교차 반응성이 보고되었습니다.

카탈로그번호
HPA008588-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008588-100 Anti-NMI Antibody, N-myc (and STAT) interactor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008588-25 Anti-NMI Antibody, N-myc (and STAT) interactor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NMI Antibody

Anti-NMI Antibody

Target: N-myc (and STAT) interactor
Product Type: Polyclonal Antibody against Human NMI


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the human NMI protein.
Affinity purified using the PrEST antigen as the affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein N-myc (and STAT) interactor
Target Gene NMI
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026946 (74%), Rat ENSRNOG00000027502 (46%)

Antigen Sequence:

KINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPH

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.