CacheBy
Atlas Antibodies Anti-NLRP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NLRP2 Antibody

상품 한눈에 보기

Human NLRP2 단백질을 인식하는 토끼 폴리클로날 항체로, WB에서 독립 항체 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 및 PBS 버퍼에 보존. 인간 시료에 적합하며, 사용 전 부드럽게 혼합 권장.

카탈로그번호
HPA021183-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021183-100 Anti-NLRP2 Antibody, NLR family, pyrin domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021183-25 Anti-NLRP2 Antibody, NLR family, pyrin domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NLRP2 Antibody

Anti-NLRP2 Antibody

Target: NLR family, pyrin domain containing 2 (NLRP2)
Supplier: Atlas Antibodies


Validation of protein expression in Western Blot (WB) by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human NLRP2.


Alternative Gene Names

CLR19.9, FLJ20510, NALP2, NBS1, PAN1, PYPAF2

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVI

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000049759 (30%)
  • Mouse ENSMUSG00000045693 (26%)

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Use WB validation with independent antibodies
Storage Gently mix before use; determine optimal concentration and conditions experimentally
Safety Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.