
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NIPAL3 Antibody
상품 한눈에 보기
인간 NIPAL3 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 높은 설치류 상동성을 보입니다. 안정화 보존제를 포함한 PBS 버퍼에 제공됩니다.
- 카탈로그번호
- HPA039978-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039978-100 Anti-NIPAL3 Antibody, NIPA-like domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039978-25 Anti-NIPAL3 Antibody, NIPA-like domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NIPAL3 Antibody
Anti-NIPAL3 Antibody
Target: NIPA-like domain containing 3 (NIPAL3)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human NIPAL3.
Alternative Gene Names
DJ462O23.2, NPAL3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NIPA-like domain containing 3 |
| Target Gene | NIPAL3 |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000037165 (90%), Mouse ENSMUSG00000028803 (87%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
VFLITRNRKKPIPFEPYISMDAMPGMQNMHDKGMTVQPELKASFSYGALENNDNISEIYAPATLPVMQEEHGSRSASGVPYRVLEHTKKE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



