CacheBy
Atlas Antibodies Anti-NIPSNAP3A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NIPSNAP3A Antibody

상품 한눈에 보기

Human NIPSNAP3A 단백질을 인식하는 고품질 Rabbit Polyclonal 항체로, WB 및 IHC에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 다양한 종 간 높은 서열 유사성을 보유.

카탈로그번호
HPA042491-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042491-100 Anti-NIPSNAP3A Antibody, nipsnap homolog 3A (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042491-25 Anti-NIPSNAP3A Antibody, nipsnap homolog 3A (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NIPSNAP3A Antibody

Anti-NIPSNAP3A Antibody

Target Information

  • Target Protein: nipsnap homolog 3A (C. elegans)
  • Target Gene: NIPSNAP3A
  • Alternative Gene Names: DKFZp564D177, FLJ13953, HSPC299, MGC14553

Product Description

Polyclonal Antibody against Human NIPSNAP3A.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    VHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIP
  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000010332 91%
Mouse ENSMUSG00000015247 89%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Usage Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.