Atlas Antibodies Anti-NICN1 Antibody

상품 한눈에 보기

인간 NICN1 단백질을 인식하는 토끼 폴리클로날 항체. PrEST 항원을 이용해 친화 정제됨. 면역세포화학(ICC) 등 연구용으로 적합. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가짐.

카탈로그번호: HPA058014-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058014-100 Anti-NICN1 Antibody, nicolin 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058014-25 Anti-NICN1 Antibody, nicolin 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NICN1 Antibody

Anti-NICN1 Antibody

Target Information

Target Protein: nicolin 1
Target Gene: NICN1
Alternative Gene Names: MGC12936

Product Description

Polyclonal antibody against human NICN1 (nicolin 1).
Affinity purified using the PrEST antigen as affinity ligand.
Recommended for research applications such as immunocytochemistry (ICC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000032606	89%
Rat	ENSRNOG00000049083	87%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Determine optimal concentrations and conditions experimentally.