CacheBy
Atlas Antibodies Anti-NGEF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NGEF Antibody

상품 한눈에 보기

Human NGEF 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, IHC 등 다양한 응용에 적합합니다. PBS 버퍼와 글리세롤로 안정화되어 장기 보관이 용이합니다.

카탈로그번호
HPA008160-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008160-100 Anti-NGEF Antibody, neuronal guanine nucleotide exchange factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008160-25 Anti-NGEF Antibody, neuronal guanine nucleotide exchange factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NGEF Antibody

Anti-NGEF Antibody

Target: Neuronal guanine nucleotide exchange factor (NGEF)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human NGEF.


Alternative Gene Names

  • ARHGEF27

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Neuronal guanine nucleotide exchange factor
Target Gene NGEF
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRTPPCRTAMQTDPGAQEMSESSST

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000026259): 48%
  • Rat (ENSRNOG00000023753): 26%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.