CacheBy
Atlas Antibodies Anti-NFKBIZ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NFKBIZ Antibody

상품 한눈에 보기

Human NFKBIZ 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합함. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. Affinity purification 방식으로 높은 특이성과 재현성을 제공.

카탈로그번호
HPA010547-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010547-100 Anti-NFKBIZ Antibody, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010547-25 Anti-NFKBIZ Antibody, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NFKBIZ Antibody

Anti-NFKBIZ Antibody

nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human NFKBIZ.

Alternative Gene Names

FLJ34463, INAP, MAIL

Open Datasheet

Target Information

항목 내용
Target Protein nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
Target Gene NFKBIZ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL

Verified Species Reactivity

Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000035356 95%
Rat ENSRNOG00000031163 89%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.