CacheBy
Atlas Antibodies Anti-NELFA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NELFA Antibody

상품 한눈에 보기

인간 NELFA 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. 토끼에서 생산된 IgG 아이소타입으로 높은 특이성과 재현성을 제공. PrEST 항원 기반 친화 정제 방식으로 제조되어 신뢰성 높은 결과 보장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039858-100 Anti-NELFA Antibody, negative elongation factor complex member A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039858-25 Anti-NELFA Antibody, negative elongation factor complex member A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NELFA Antibody

Anti-NELFA Antibody

Target Information

  • Target Protein: Negative elongation factor complex member A
  • Target Gene: NELFA
  • Alternative Gene Names: NELF-A, WHSC2
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NELFA.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000015474 (99%)
  • Mouse ENSMUSG00000029111 (99%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Datasheet Open Datasheet (PDF)
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.