CacheBy
Atlas Antibodies Anti-NEDD4L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEDD4L Antibody

상품 한눈에 보기

인간 NEDD4L 단백질을 인식하는 토끼 폴리클로날 항체로, E3 유비퀴틴 리가아제 연구에 적합합니다. 높은 종간 보존성(인간, 마우스, 랫트 97%)을 보이며, PrEST 항원으로 친화 정제되었습니다. IHC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024618-100 Anti-NEDD4L Antibody, neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024618-25 Anti-NEDD4L Antibody, neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEDD4L Antibody

Anti-NEDD4L Antibody

neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase


면역조직화학(IHC)


Product Description

Polyclonal Antibody against Human NEDD4L


Alternative Gene Names

  • KIAA0439
  • NEDD4-2
  • RSP5

Open Datasheet


Target Information

항목 내용
Target Protein neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
Target Gene NEDD4L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000024589 (97%)
Rat ENSRNOG00000017610 (97%)

Antigen Sequence

SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEM


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.