CacheBy
Atlas Antibodies Anti-NDUFB8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NDUFB8 Antibody

상품 한눈에 보기

인간 NDUFB8 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체, 쥐, 랫드 간 교차 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065549-100 Anti-NDUFB8 Antibody, NADH:ubiquinone oxidoreductase subunit B8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065549-25 Anti-NDUFB8 Antibody, NADH:ubiquinone oxidoreductase subunit B8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NDUFB8 Antibody

Anti-NDUFB8 Antibody

Target: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19 kDa)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human NDUFB8.

Alternative Gene Names

  • ASHI
  • CI-ASHI

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19 kDa
Target Gene NDUFB8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDM

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000014078): 86%
  • Mouse (ENSMUSG00000025204): 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.