CacheBy
Atlas Antibodies Anti-NCOA7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCOA7 Antibody

상품 한눈에 보기

인간 NCOA7 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며 PrEST 항원으로 정제됨. Human 종에 반응성이 검증됨. 안정적 보존을 위한 글리세롤 및 PBS 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030289-100 Anti-NCOA7 Antibody, nuclear receptor coactivator 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030289-25 Anti-NCOA7 Antibody, nuclear receptor coactivator 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCOA7 Antibody

Anti-NCOA7 Antibody

Target Information

  • Target Protein: Nuclear receptor coactivator 7
  • Target Gene: NCOA7
  • Alternative Gene Names: dJ187J11.3, ERAP140, TLDC4

면역조직화학(IHC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal antibody against human NCOA7.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NDVELKGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENLQKTELSDG

Species Reactivity

  • Verified: Human
  • Interspecies Information:
    • Mouse (ENSMUSG00000039697) – 75% identity
    • Rat (ENSRNOG00000014004) – 73% identity

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Material Safety Data Sheet MSDS - Sodium Azide

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도 및 조건은 사용자가 실험적으로 결정해야 합니다.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.