CacheBy
Atlas Antibodies Anti-NCOA7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCOA7 Antibody

상품 한눈에 보기

인간 NCOA7 단백질을 인식하는 토끼 폴리클로날 항체. 핵 수용체 보조활성화인자 연구에 적합. IHC 등 다양한 응용에 사용 가능. PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030290-100 Anti-NCOA7 Antibody, nuclear receptor coactivator 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030290-25 Anti-NCOA7 Antibody, nuclear receptor coactivator 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCOA7 Antibody

Anti-NCOA7 Antibody

Target: Nuclear receptor coactivator 7 (NCOA7)

Product Description

Polyclonal antibody against human NCOA7 protein. Suitable for use in various immunoassays including immunohistochemistry (IHC).

Alternative Gene Names

dJ187J11.3, ERAP140, TLDC4

Open Datasheet (PDF)

Target Information

  • Protein: Nuclear receptor coactivator 7
  • Gene: NCOA7

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NDVELKGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENLQKTELSDG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000039697): 75%
  • Rat (ENSRNOG00000014004): 73%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Immunohistochemistry (IHC)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.