CacheBy
Atlas Antibodies Anti-NBAS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NBAS Antibody

상품 한눈에 보기

Human NBAS 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대해 검증되었으며, Mouse 및 Rat과 83% 서열 일치도를 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036817-100 Anti-NBAS Antibody, neuroblastoma amplified sequence 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036817-25 Anti-NBAS Antibody, neuroblastoma amplified sequence 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NBAS Antibody

Anti-NBAS Antibody

Target Information

  • Target Protein: neuroblastoma amplified sequence
  • Target Gene: NBAS
  • Alternative Gene Names: NAG
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NBAS.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    AKGDLKFPLKIFQHSKPDLQQKIIPDQDQLMAIALECIYTCERNDQLCLCYDLLECLPERGYGDKTEATTKLHDMVDQLEQILSVS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000020576): 83%
  • Rat (ENSRNOG00000024503): 83%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

Additional Resources

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.