CacheBy
Atlas Antibodies Anti-NAXD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAXD Antibody

상품 한눈에 보기

인간 NAXD 단백질을 타깃으로 하는 폴리클로날 항체. NAD(P)HX dehydratase 검출용으로 적합하며, 토끼 유래 IgG 형식. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010551-100 Anti-NAXD Antibody, NAD(P)HX dehydratase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010551-25 Anti-NAXD Antibody, NAD(P)HX dehydratase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAXD Antibody

Anti-NAXD Antibody

Target Information

  • Target Protein: NAD(P)HX dehydratase
  • Target Gene: NAXD
  • Alternative Gene Names: CARKD, FLJ10769, LP3298

Product Description

Polyclonal antibody against human NAXD.
Recommended for applications such as immunohistochemistry (IHC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKAVLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQALGNVTVVQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000031505 (82%)
  • Rat ENSRNOG00000015021 (80%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications IHC
Verified Reactivity Human

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.