
원본
Thermo Fisher Scientific FGF8 Monoclonal Antibody (3H2)
상품 한눈에 보기
FGF8 단백질을 인식하는 Mouse IgG2a 단클론 항체로, 인간 시료에 반응합니다. Western blot과 ELISA에 적합하며, 배아 발달 및 신경세포 분화 연구에 활용됩니다. 액상 형태로 제공되며 PBS buffer에 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 08:01
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific H00002253-M06 FGF8 Monoclonal Antibody (3H2) 100 ug pk판매 단위 pk ·
재고 확인 필요
518,100원VAT 포함 569,910원
Thermo Fisher Scientific · Thermo Fisher Scientific FGF8 Monoclonal Antibody (3H2)
Applications
Western Blot (WB)
- Tested Dilution: 1–5 µg/mL
ELISA
- Tested Dilution: 0.3 ng/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG2a, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 3H2 |
| Immunogen | FGF8 (NP_149354, 65–133 a.a.) full-length recombinant protein with GST tag (MW of GST tag: 26 kDa) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid freeze/thaw cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein is as follows:
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK
Target Information
FGF8는 배아 발달, 세포 증식, 분화 및 이동 조절에 중요한 역할을 합니다.
정상적인 뇌, 눈, 귀 및 사지 발달에 필요하며, 생식샘자극호르몬(GnRH) 신경계의 정상 발달에도 필수적입니다.
또한 해마 세포에서 신경돌기 성장(neurite outgrowth)에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
