AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NANS Antibody
상품 한눈에 보기
인간 NANS 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 토끼 유래 IgG 형태로 높은 특이성과 순도를 제공. 인간, 생쥐, 랫트 반응성 검증 완료.
- 카탈로그번호
- HPA019223-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019223-100 Anti-NANS Antibody, N-acetylneuraminic acid synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019223-25 Anti-NANS Antibody, N-acetylneuraminic acid synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NANS Antibody
Anti-NANS Antibody
Target Information
- Target Protein: N-acetylneuraminic acid synthase
- Target Gene: NANS
- Alternative Gene Name: SAS
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human NANS.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHG
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Homology
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000008945 | 88% |
| Mouse | ENSMUSG00000028334 | 86% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02% (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.