CacheBy
Atlas Antibodies Anti-NAGK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAGK Antibody

상품 한눈에 보기

Human NAGK 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 높은 종간 서열 동일성을 보여줍니다. 40% 글리세롤 PBS 버퍼에 보존되어 안정적입니다.

카탈로그번호
HPA035207-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035207-100 Anti-NAGK Antibody, N-acetylglucosamine kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035207-25 Anti-NAGK Antibody, N-acetylglucosamine kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAGK Antibody

Anti-NAGK Antibody

Target Protein: N-acetylglucosamine kinase
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
  • WB (Western Blot)

Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human NAGK.


Alternative Gene Names

  • GNK

Open Datasheet


Target Information

항목 내용
Target Protein N-acetylglucosamine kinase
Target Gene NAGK
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000013911 (88%), Mouse ENSMUSG00000034744 (87%)

Antigen Sequence:
SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.