Atlas Antibodies Anti-NAA40 Antibody

상품 한눈에 보기

인간 NAA40 단백질을 인식하는 폴리클로날 항체로 IHC 및 ICC에 적합. Rabbit 유래 IgG, PrEST 항원으로 Affinity 정제. 높은 종간 서열 일치도(마우스 99%, 랫 97%)를 보유. PBS/glycerol 버퍼에 sodium azide 보존제 포함.

카탈로그번호: HPA056142-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056142-100 Anti-NAA40 Antibody, N(alpha)-acetyltransferase 40, NatD catalytic subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056142-25 Anti-NAA40 Antibody, N(alpha)-acetyltransferase 40, NatD catalytic subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NAA40 Antibody

Anti-NAA40 Antibody

N(alpha)-acetyltransferase 40, NatD catalytic subunit

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NAA40.

Alternative Gene Names

FLJ13848, NAT11

Open Datasheet

Target Information

Target Protein: N(alpha)-acetyltransferase 40, NatD catalytic subunit
Target Gene: NAA40

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000024764 (99%)
Rat ENSRNOG00000021179 (97%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand