CacheBy
Atlas Antibodies Anti-NAA15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAA15 Antibody

상품 한눈에 보기

Human NAA15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 높은 종간 보존성을 가지며 PrEST 항원으로 친화 정제되었습니다. 40% glycerol/PBS 버퍼에 보존제가 포함되어 있습니다.

카탈로그번호
HPA050661-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050661-100 Anti-NAA15 Antibody, N(alpha)-acetyltransferase 15, NatA auxiliary subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050661-25 Anti-NAA15 Antibody, N(alpha)-acetyltransferase 15, NatA auxiliary subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAA15 Antibody

Anti-NAA15 Antibody

Target: N(alpha)-acetyltransferase 15, NatA auxiliary subunit
Type: Polyclonal Antibody against Human NAA15


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human NAA15, a subunit of the N(alpha)-acetyltransferase complex NatA.


Alternative Gene Names

FLJ13340, NARG1, NATH, TBDN100

Open Datasheet


Target Information

항목 내용
Target Protein N(alpha)-acetyltransferase 15, NatA auxiliary subunit
Target Gene NAA15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG
Verified Species Reactivity Human
Interspecies Identity Mouse (99%), Rat (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.