CacheBy
Atlas Antibodies Anti-N4BP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-N4BP2 Antibody

상품 한눈에 보기

인간 N4BP2 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, Rabbit IgG 형태로 제공됩니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장합니다. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA042607-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042607-100 Anti-N4BP2 Antibody, NEDD4 binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042607-25 Anti-N4BP2 Antibody, NEDD4 binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-N4BP2 Antibody

Anti-N4BP2 Antibody

Target: NEDD4 binding protein 2 (N4BP2)
Type: Polyclonal Antibody against Human N4BP2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human N4BP2, also known as NEDD4 binding protein 2.


Alternative Gene Names

  • B3BP

Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    FSLGLNLKEIISQRGTLENSNSPVPEFSHGIGISNADSQSTCDAERGNSEQAEMRAVTPENHESMTSIFPSAAVGLKNNNDILPNSQEEL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000037795 57%
Rat ENSRNOG00000027152 56%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.