CacheBy
Atlas Antibodies Anti-MZB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MZB1 Antibody

상품 한눈에 보기

Human MZB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증을 통해 높은 특이성과 신뢰성을 제공합니다. PrEST 항원으로 정제되었으며, 인간 시료에 적합합니다. 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

카탈로그번호
HPA043745-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043745-100 Anti-MZB1 Antibody, marginal zone B and B1 cell-specific protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043745-25 Anti-MZB1 Antibody, marginal zone B and B1 cell-specific protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MZB1 Antibody

Anti-MZB1 Antibody

Marginal zone B and B1 cell-specific protein


  • Orthogonal validation: Protein expression verified by IHC compared to RNA-seq data in high and low expression tissues.
  • Independent antibody validation: Protein expression confirmed in WB using different antibodies targeting distinct epitopes.

Product Description

Polyclonal antibody against Human MZB1


Alternative Gene Names

HSPC190, MEDA-7, MGC29506, PACAP, pERp1

Open Datasheet


Target Information

항목 내용
Target Protein Marginal zone B and B1 cell-specific protein
Target Gene MZB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR

Species Reactivity

항목 내용
Verified Species Human
Interspecies Identity Rat ENSRNOG00000022009 (74%), Mouse ENSMUSG00000024353 (73%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.