Atlas Antibodies Anti-MZB1 Antibody
상품 한눈에 보기
Human MZB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증을 통해 높은 특이성과 신뢰성을 제공합니다. PrEST 항원으로 정제되었으며, 인간 시료에 적합합니다. 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MZB1 Antibody
Marginal zone B and B1 cell-specific protein
Recommended Applications
- Orthogonal validation: Protein expression verified by IHC compared to RNA-seq data in high and low expression tissues.
- Independent antibody validation: Protein expression confirmed in WB using different antibodies targeting distinct epitopes.
Product Description
Polyclonal antibody against Human MZB1
Alternative Gene Names
HSPC190, MEDA-7, MGC29506, PACAP, pERp1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Marginal zone B and B1 cell-specific protein |
| Target Gene | MZB1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Interspecies Identity | Rat ENSRNOG00000022009 (74%), Mouse ENSMUSG00000024353 (73%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.